PDB entry 1mr6

View 1mr6 on RCSB PDB site
Description: Solution Structure of gamma-Bungarotoxin:Implication for the role of the Residues Adjacent to RGD in Integrin Binding
Class: toxin
Keywords: neurotoxin, venom
Deposited on 2002-09-18, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin
    Species: Bungarus multicinctus [TaxId:8616]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mr6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mr6A (A:)
    mqcktcsfytcpnsetcpdgknicvkrswtavrgdgpkreirrecaatcppsklgltvfc
    cttdncnh