PDB entry 1mr5

View 1mr5 on RCSB PDB site
Description: orthorhombic form of trypanosoma cruzi trans-sialidase
Deposited on 2002-09-18, released 2003-03-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mr5A (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr5A (A:)
    gssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdnsli
    dtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsywtsh
    gdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagvai
    vasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkliin
    trvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvmlft
    hplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheinsnev
    yslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsatktew
    edayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvtihe
    vpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvltma
    nkigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllynrql
    naeeirtlflsqdligteahm