PDB entry 1mr3

View 1mr3 on RCSB PDB site
Description: Saccharomyces cerevisiae ADP-ribosylation Factor 2 (ScArf2) complexed with GDP-3'P at 1.6A resolution
Class: signaling protein
Keywords: GTP-binding, GDP-3'Phosphate, small GTPase, signal transduction, SIGNALING PROTEIN
Deposited on 2002-09-17, released 2002-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'F':
    Compound: ADP-ribosylation factor 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mr3f_
  • Heterogens: MG, G3D, EDO, GOL, EOH, PDO, HOH

PDB Chain Sequences:

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1mr3F (F:)
    mglyasklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvetvqykn
    isftvwdvggqdrirslwrhyyrntegvifvidsndrsrigearevmqrmlnedelrnav
    wlvfankqdlpeamsaaeiteklglhsirnrpwfiqstcatsgeglyeglewlsnnlknq
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr3F (F:)
    asklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvetvqyknisft
    vwdvggqdrirslwrhyyrntegvifvidsndrsrigearevmqrmlnedelrnavwlvf
    ankqdlpeamsaaeiteklglhsirnrpwfiqstcatsgeglyeglewlsnnlknqs