PDB entry 1mr1

View 1mr1 on RCSB PDB site
Description: Crystal Structure of a Smad4-Ski Complex
Class: signaling protein
Keywords: Smad, Ski, cancer, TGF-b signaling, protein interaction, SIGNALING PROTEIN
Deposited on 2002-09-17, released 2003-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.231
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mothers against decapentaplegic homolog 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mr1a_
  • Chain 'B':
    Compound: Mothers against decapentaplegic homolog 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mr1b_
  • Chain 'C':
    Compound: Ski oncogene
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12755 (4-End)
      • cloning artifact (1-3)
    Domains in SCOPe 2.07: d1mr1c1, d1mr1c2
  • Chain 'D':
    Compound: Ski oncogene
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12755 (4-End)
      • cloning artifact (2-3)
    Domains in SCOPe 2.07: d1mr1d1, d1mr1d2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mr1A (A:)
    mapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaie
    rarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikv
    fdlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvddlrr
    lcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr1A (A:)
    apeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaier
    arlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikvf
    dlrqchrqmqqqaataqaaaaaqvddlrrlcilrmsfvkgwgpdyprqsiketpcwieih
    lhralqlldevlhtm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mr1B (B:)
    mapeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaie
    rarlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikv
    fdlrqchrqmqqqaataqaaaaaqaaavagnipgpgsvggiapaislsaaagigvddlrr
    lcilrmsfvkgwgpdyprqsiketpcwieihlhralqlldevlhtmpiadpqpld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr1B (B:)
    apeywcsiayfemdvqvgetfkvpsscpivtvdgyvdpsggdrfclgqlsnvhrteaier
    arlhigkgvqleckgegdvwvrclsdhavfvqsyyldreagrapgdavhkiypsayikvf
    dlrqchrqmqqqaavddlrrlcilrmsfvkgwgpdyprqsiketpcwieihlhralqlld
    evlhtmpiadpqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mr1C (C:)
    gshmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchw
    gfdsanwrayillsqdytgkeeqarlgrclddvkekfdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr1C (C:)
    shmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwg
    fdsanwrayillsqdytgkeeqarlgrclddvkekfd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mr1D (D:)
    gshmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchw
    gfdsanwrayillsqdytgkeeqarlgrclddvkekfdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr1D (D:)
    hmrvyhecfgkckgllvpelysspsaaciqcldcrlmypphkfvvhshkalenrtchwgf
    dsanwrayillsqdytgkeeqarlgrclddvkekfd