PDB entry 1mqr

View 1mqr on RCSB PDB site
Description: the crystal structure of alpha-d-glucuronidase (e386q) from bacillus stearothermophilus t-6
Deposited on 2002-09-17, released 2003-09-17
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.179
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqrA (A:)
    mtagyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqev
    netansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfh
    flrllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqri
    kdyarllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyas
    pieigglptadpldpevrrwwketakriyqyipdfggfvvkadsefrpgpftygrdhaeg
    anmlaealapfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikn
    gpmdfqvrepvsplfgampktnqmmqvqitqeytgqqkhlcflipqwkevldfdtyakgk
    gsevkkvidgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeia
    newvvqtfgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshw
    gtyhyadrdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhs
    getviqhiynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvin
    tyfyrksgiddqygrkiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqrA (A:)
    agyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevne
    tansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhfl
    rllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvknqrikdy
    arllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyaspie
    igglptadpldpevrrwwketakriyqyipdfggfvvkadsefrpgpftygrdhaeganm
    laealapfgglviwrcfvcqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdf
    qvrepvsplfgampktnqmmqvqitqeytgqqkhlcflipqwkevldfdtyakgkgsevk
    kvidgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvv
    qtfgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhy
    adrdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetvi
    qhiynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyr
    ksgiddqygrkiyr