PDB entry 1mqp

View 1mqp on RCSB PDB site
Description: the crystal structure of alpha-d-glucuronidase from bacillus stearothermophilus t-6
Deposited on 2002-09-17, released 2003-09-23
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-17, with a file datestamp of 2004-02-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqpA (A:)
    mtagyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqev
    netansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfh
    flrllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqri
    kdyarllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyas
    pieigglptadpldpevrrwwketakriyqyipdfggfvvkadsefrpgpftygrdhaeg
    anmlaealapfgglviwrcfvyncqqdwrdrttdrakaaydhfkpldgqfrenvilqikn
    gpmdfqvrepvsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgk
    gsevkkvidgslfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeia
    newvvqtfgddsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshw
    gtyhyadrdgigvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhs
    getviqhiynthfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvin
    tyfyrksgiddqygrkiyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqpA (A:)
    agyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevne
    tansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhfl
    rllqmgeniaqlsiieqpknrlrminhwdnmdgsiergyagrsiffvddqfvkqnqrikd
    yarllasvginaisinnvnvhktetklitdhflpdvaevadifrtygiktflsinyaspi
    eigglptadpldpevrrwwketakriyqyipdfggfvvkarpgpftygrdhaeganmlae
    alapfgglviwrccqqdwrdrttdrakaaydhfkpldgqfrenvilqikngpmdfqvrep
    vsplfgampktnqmmevqitqeytgqqkhlcflipqwkevldfdtyakgkgsevkkvidg
    slfdyrysgiagvsnigsdpnwtghtlaqanlygfgrlawnpdlsaeeianewvvqtfgd
    dsqvvetiswmllsswriyenytsplgvgwmvnpghhygpnvdgyeyshwgtyhyadrdg
    igvdrtvatgtgytaqyfpenaamyesldtcpdelllffhhvpythrlhsgetviqhiyn
    thfegveqakqlrkrweqlkgkidekryhdvlerltiqvehakewrdvintyfyrksgid
    dqygrkiyr