PDB entry 1mqm

View 1mqm on RCSB PDB site
Description: BHA/LSTa
Class: Viral protein
Keywords: influenza virus, Viral protein
Deposited on 2002-09-16, released 2003-08-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.265
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mqma_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mqmb_
  • Chain 'D':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mqmd_
  • Chain 'E':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mqme_
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mqmg_
  • Chain 'H':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mqmh_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqmA (A:)
    qdlpgndnstatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrild
    gractlidallgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlef
    itegftwtgvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqmA (A:)
    statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
    allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
    gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mqmB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqikgvelks
    gykdwilwisfaisclllcvvllgfimwacqrgnircnici
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqmB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mqmD (D:)
    qdlpgndnstatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrild
    gractlidallgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlef
    itegftwtgvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqmD (D:)
    statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
    allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
    gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mqmE (E:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqikgvelks
    gykdwilwisfaisclllcvvllgfimwacqrgnircnici
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqmE (E:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mqmG (G:)
    qdlpgndnstatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrild
    gractlidallgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlef
    itegftwtgvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqmG (G:)
    statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
    allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
    gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mqmH (H:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqikgvelks
    gykdwilwisfaisclllcvvllgfimwacqrgnircnici
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqmH (H:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq