PDB entry 1mql

View 1mql on RCSB PDB site
Description: BHA of Ukr/63
Class: Viral protein
Keywords: influenza a virus, Viral protein
Deposited on 2002-09-16, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.269
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mqla_
  • Chain 'B':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mqlb_
  • Chain 'D':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mqld_
  • Chain 'E':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mqle_
  • Chain 'G':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mqlg_
  • Chain 'H':
    Compound: Hemagglutinin HA2 chain
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mqlh_
  • Heterogens: NAG, NDG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqlA (A:)
    qdlpgndnstatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrild
    gractlidallgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlef
    itegftwtgvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqlA (A:)
    statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
    allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
    gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mqlB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqikgvelks
    gykdwilwisfaisclllcvvllgfimwacqrgnircnici
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqlB (B:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mqlD (D:)
    qdlpgndnstatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrild
    gractlidallgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlef
    itegftwtgvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqlD (D:)
    statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
    allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
    gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mqlE (E:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqikgvelks
    gykdwilwisfaisclllcvvllgfimwacqrgnircnici
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqlE (E:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1mqlG (G:)
    qdlpgndnstatlclghhavpngtivktitddqievtnatelvqssstgkicnnphrild
    gractlidallgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlef
    itegftwtgvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiw
    gvhhpstnqeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpg
    dvlvinsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnki
    tygacpkyvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqlG (G:)
    statlclghhavpngtivktitddqievtnatelvqssstgkicnnphrildgractlid
    allgdphcdvfqnetwdlfversnafsncypydipdyaslrslvassgtlefitegftwt
    gvtqnggssackrgpangffsrlnwltksesaypvlnvtmpnndnfdklyiwgvhhpstn
    qeqtnlyvqasgrvtvstrrsqqtiipnigsrpwvrgqpgrisiywtivkpgdvlvinsn
    gnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpky
    vkqntlklatgmrnvpek
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mqlH (H:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfqikgvelks
    gykdwilwisfaisclllcvvllgfimwacqrgnircnici
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqlH (H:)
    glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqinrklnrviektn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidladsemnklfe
    ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdiyrdealnnrfq