PDB entry 1mqk

View 1mqk on RCSB PDB site
Description: Crystal structure of the unliganded Fv-fragment of the anti-cytochrome C oxidase antibody 7E2
Class: immune system
Keywords: antibody, membrane protein, cytochrome C oxidase, high-resolution structure, IMMUNE SYSTEM
Deposited on 2002-09-16, released 2003-04-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.136
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: antibody 7E2 FV fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mqkh_
  • Chain 'L':
    Compound: antibody 7E2 FV fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mqkl_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mqkH (H:)
    evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
    pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssaw
    rhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqkH (H:)
    evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
    pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssaw
    rhp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mqkL (L:)
    dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
    rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleikreqkliseedlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqkL (L:)
    dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
    rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleikr