PDB entry 1mqk

View 1mqk on RCSB PDB site
Description:
Deposited on 2002-09-16, released 2003-04-01
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-01, with a file datestamp of 2003-04-01.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: 0.136
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mqkh_
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mqkl_

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mqkH (H:)
    evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
    pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssaw
    rhpqfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqkH (H:)
    evklqesggdlvqpggslklscaasgftfssytmswvrqtpekrlewvasinngggrtyy
    pdtvkgrftisrdnakntlylqmsslksedtamyycvrheyyyamdywgqgttvtvssaw
    rhp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mqkL (L:)
    dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
    rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleikreqkliseedlm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqkL (L:)
    dieltqtpvslsasvgetvtitcraseniysylawyqqkqgkspqflvynaktlgegvps
    rfsgsgsgtqfslkinsllpedfgsyycqhhygtppltfgggtkleikr