PDB entry 1mqf

View 1mqf on RCSB PDB site
Description: Compound I from Proteus mirabilis catalase
Class: oxidoreductase
Keywords: alpha + beta, OXIDOREDUCTASE
Deposited on 2002-09-16, released 2002-10-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catalase
    Species: Proteus mirabilis [TaxId:584]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42321
      • modified residue (52)
    Domains in SCOPe 2.07: d1mqfa_
  • Heterogens: SO4, O, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqfA (A:)
    mekkklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsga
    fgtftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteeg
    nwdmvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidms
    drglplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdress
    qrdlfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrn
    pdnyfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcp
    fhnyhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfs
    qpralyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvleg
    kdak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqfA (A:)
    kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
    ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
    mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
    lplsyrfvhgfgshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
    lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
    yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
    yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
    alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle