PDB entry 1mqb

View 1mqb on RCSB PDB site
Description: Crystal Structure of Ephrin A2 (ephA2) Receptor Protein Kinase
Deposited on 2002-09-16, released 2003-09-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-16, with a file datestamp of 2003-09-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mqba_
  • Chain 'B':
    Domains in SCOP 1.67: d1mqbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqbA (A:)
    msyyhhhhhhdydipttenlyfqgamgsdpnqavlkftteihpscvtrqkvigagefgev
    ykgmlktssgkkevpvaiktlkagytekqrvdflgeagimgqfshhniirlegviskykp
    mmiiteymengaldkflrekdgefsvlqlvgmlrgiaagmkylanmnyvhrdlaarnilv
    nsnlvckvsdfglsrvleddpeatyttsggkipirwtapeaisyrkftsasdvwsfgivm
    wevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkfadi
    vsildklirapdslktladfdprvsirlpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqbA (A:)
    tteihpscvtrqkvigagefgevykgmlktkkevpvaiktlkagytekqrvdflgeagim
    gqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaagm
    kylanmnyvhrdlaarnilvnsnlvckvsdfglkipirwtapeaisyrkftsasdvwsfg
    ivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkf
    adivsildklirapdslktladf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mqbB (B:)
    msyyhhhhhhdydipttenlyfqgamgsdpnqavlkftteihpscvtrqkvigagefgev
    ykgmlktssgkkevpvaiktlkagytekqrvdflgeagimgqfshhniirlegviskykp
    mmiiteymengaldkflrekdgefsvlqlvgmlrgiaagmkylanmnyvhrdlaarnilv
    nsnlvckvsdfglsrvleddpeatyttsggkipirwtapeaisyrkftsasdvwsfgivm
    wevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkfadi
    vsildklirapdslktladfdprvsirlpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqbB (B:)
    lkftteihpscvtrqkvigagefgevykgmlktkevpvaiktlkagytekqrvdflgeag
    imgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaa
    gmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvlkipirwtapeaisyrkftsas
    dvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqer
    arrpkfadivsildklirapdslkt