PDB entry 1mqb

View 1mqb on RCSB PDB site
Description: Crystal Structure of Ephrin A2 (ephA2) Receptor Protein Kinase
Class: transferase
Keywords: Tyrosine Protein Kinase, TRANSFERASE
Deposited on 2002-09-16, released 2003-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EphA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mqba_
  • Chain 'B':
    Compound: Ephrin type-A receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: EphA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mqbb_
  • Heterogens: ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mqbA (A:)
    msyyhhhhhhdydipttenlyfqgamgsdpnqavlkftteihpscvtrqkvigagefgev
    ykgmlktssgkkevpvaiktlkagytekqrvdflgeagimgqfshhniirlegviskykp
    mmiiteymengaldkflrekdgefsvlqlvgmlrgiaagmkylanmnyvhrdlaarnilv
    nsnlvckvsdfglsrvleddpeatyttsggkipirwtapeaisyrkftsasdvwsfgivm
    wevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkfadi
    vsildklirapdslktladfdprvsirlpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqbA (A:)
    tteihpscvtrqkvigagefgevykgmlktkkevpvaiktlkagytekqrvdflgeagim
    gqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaagm
    kylanmnyvhrdlaarnilvnsnlvckvsdfglkipirwtapeaisyrkftsasdvwsfg
    ivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkf
    adivsildklirapdslktladf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mqbB (B:)
    msyyhhhhhhdydipttenlyfqgamgsdpnqavlkftteihpscvtrqkvigagefgev
    ykgmlktssgkkevpvaiktlkagytekqrvdflgeagimgqfshhniirlegviskykp
    mmiiteymengaldkflrekdgefsvlqlvgmlrgiaagmkylanmnyvhrdlaarnilv
    nsnlvckvsdfglsrvleddpeatyttsggkipirwtapeaisyrkftsasdvwsfgivm
    wevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqerarrpkfadi
    vsildklirapdslktladfdprvsirlpstsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mqbB (B:)
    lkftteihpscvtrqkvigagefgevykgmlktkevpvaiktlkagytekqrvdflgeag
    imgqfshhniirlegviskykpmmiiteymengaldkflrekdgefsvlqlvgmlrgiaa
    gmkylanmnyvhrdlaarnilvnsnlvckvsdfglsrvlkipirwtapeaisyrkftsas
    dvwsfgivmwevmtygerpywelsnhevmkaindgfrlptpmdcpsaiyqlmmqcwqqer
    arrpkfadivsildklirapdslkt