PDB entry 1mq4

View 1mq4 on RCSB PDB site
Description: Crystal Structure of Aurora-A Protein Kinase
Class: transferase
Keywords: Protein kinase structure, TRANSFERASE
Deposited on 2002-09-13, released 2003-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.227
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aurora-related kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mq4a_
  • Heterogens: MG, PO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mq4A (A:)
    gamgskrqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlr
    reveiqshlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyite
    lanalsychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppe
    miegrmhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardl
    isrllkhnpsqrpmlrevlehpwitansskps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mq4A (A:)
    rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
    shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
    ychskrvihrdikpenlllgsagelkiadfgwsvhapssrtlcgtldylppemiegrmhd
    ekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllkhn
    psqrpmlrevlehpwitanss