PDB entry 1mq1

View 1mq1 on RCSB PDB site
Description: Ca2+-S100B-TRTK-12 complex
Class: metal binding protein
Keywords: protein-peptide complex, EF-hand
Deposited on 2002-09-13, released 2002-12-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-05-31, with a file datestamp of 2007-06-04.
Experiment type: NMR17
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-100 protein, beta chain
    Species: HOMO SAPIENS
    Gene: S100beta
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mq1a_
  • Chain 'B':
    Compound: S-100 protein, beta chain
    Species: HOMO SAPIENS
    Gene: S100beta
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mq1b_
  • Chain 'C':
    Compound: F-actin capping protein alpha-1 subunit
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: F-actin capping protein alpha-1 subunit
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mq1A (A:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dndgdgecdfqefmafvamvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mq1B (B:)
    selekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
    dndgdgecdfqefmafvamvttacheffehe
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.