PDB entry 1mq0

View 1mq0 on RCSB PDB site
Description: crystal structure of human cytidine deaminase
Deposited on 2002-09-13, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-04, with a file datestamp of 2003-11-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mq0a_
  • Chain 'B':
    Domains in SCOP 1.67: d1mq0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mq0A (A:)
    gshmkpecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgica
    ertaiqkavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyiv
    mtvqellpssfgpedlqktq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mq0A (A:)
    ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
    kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
    lpssfgpedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mq0B (B:)
    gshmkpecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgica
    ertaiqkavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyiv
    mtvqellpssfgpedlqktq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mq0B (B:)
    ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
    kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
    lpssfgpedl