PDB entry 1mq0

View 1mq0 on RCSB PDB site
Description: Crystal Structure of Human Cytidine Deaminase
Class: hydrolase
Keywords: human, enzyme, cytidine deaminase, amine hydrolase, inhibitor, diazepinone, leukemia, chemotherapy, anticancer, drug, phi-phi interaction, edge-to-face interaction, protein, hydrolase
Deposited on 2002-09-13, released 2003-11-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytidine deaminase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32320
      • engineered (20)
    Domains in SCOPe 2.07: d1mq0a_
  • Chain 'B':
    Compound: Cytidine deaminase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32320
      • engineered (20)
    Domains in SCOPe 2.07: d1mq0b_
  • Heterogens: ZN, BRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mq0A (A:)
    gshmkpecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgica
    ertaiqkavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyiv
    mtvqellpssfgpedlqktq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mq0A (A:)
    ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
    kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
    lpssfgpedl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mq0B (B:)
    gshmkpecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgica
    ertaiqkavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyiv
    mtvqellpssfgpedlqktq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mq0B (B:)
    ecvqqllvcsqeakqsaycpyshfpvgaalltqegrifkgcnienacyplgicaertaiq
    kavsegykdfraiaiasdmqddfispcgacrqvmrefgtnwpvymtkpdgtyivmtvqel
    lpssfgpedl