PDB entry 1mpz

View 1mpz on RCSB PDB site
Description: NMR solution structure of native Viperidae lebetina obtusa protein
Class: hydrolase
Keywords: disintegrin, HYDROLASE
Deposited on 2002-09-13, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Obtustatin
  Species: Macrovipera lebetina obtusa [TaxId:209528]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83469 (0-40)
  Domains in SCOPe 2.07: d1mpza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mpzA (A:)
  cttgpccrqcklkpagttcwktsltshyctgkscdcplypg