PDB entry 1mpt

View 1mpt on RCSB PDB site
Description: crystal structure of a new alkaline serine protease (m-protease) from bacillus sp. ksm-k16
Class: serine proteinase
Keywords: serine proteinase
Deposited on 1994-04-13, released 1994-06-22
The last revision prior to the SCOP 1.73 freeze date was dated 1994-06-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: m-protease
    Species: Bacillus clausii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1mpta_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mptA (A:)
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagvaalvkqknpswsnvqi
rnhlkntatglgntnlygsglvnaeaatr