PDB entry 1mpp

View 1mpp on RCSB PDB site
Description: x-ray analyses of aspartic proteinases. v. structure and refinement at 2.0 angstroms resolution of the aspartic proteinase from mucor pusillus
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1992-02-19, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pepsin
    Species: Rhizomucor pusillus [TaxId:4840]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09177 (Start-359)
      • conflict (131)
      • conflict (186)
      • conflict (222)
    Domains in SCOPe 2.07: d1mppa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mppA (A:)
    aegdgsvdtpglydfdleeyaipvsigtpgqdfyllfdtgssdtwvphkgcdnsegcvgk
    rffdpsssstfketdynlnitygtggangiyfrdsitvggatvkqqtlayvdnvsgptae
    qspdselfldgifgaaypdntameaeygdtyntvhvnlykqglisspvfsvymntndggg
    qvvfggvnntllggdiqytdvlksrggyffwdapvtgvkidgsdavsfdgaqaftidtgt
    nffiapssfaekvvkaalpdatesqqgytvpcskyqdskttfslvlqksgsssdtidvsv
    piskmllpvdksgetcmfivlpdggnqfivgnlflrffvnvydfgknrigfaplasgyen
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mppA (A:)
    gsvdtpglydfdleeyaipvsigtpgqdfyllfdtgssdtwvphkgcdnsegcvgkrffd
    psssstfketdynlnitygtggangiyfrdsitvggatvkqqtlayvdnvsgptaeqspd
    selfldgifgaaypdntameaeygdtyntvhvnlykqglisspvfsvymntndgggqvvf
    ggvnntllggdiqytdvlksrggyffwdapvtgvkidgsdavsfdgaqaftidtgtnffi
    apssfaekvvkaalpdatesqqgytvpcskyqdskttfslvlqksgsssdtidvsvpisk
    mllpvdksgetcmfivlpdggnqfivgnlflrffvnvydfgknrigfaplasgyend