PDB entry 1mpj

View 1mpj on RCSB PDB site
Description: x-ray crystallographic studies on hexameric insulins in the presence of helix-stabilizing agents, thiocyanate, methylparaben and phenol
Deposited on 1995-09-13, released 1996-01-29
The last revision prior to the SCOP 1.55 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.1893
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1mpj.1
  • Chain 'B':
    Domains in SCOP 1.55: d1mpj.1
  • Chain 'C':
    Domains in SCOP 1.55: d1mpj.2
  • Chain 'D':
    Domains in SCOP 1.55: d1mpj.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpjA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpjB (B:)
    vnqhlcgshlvealylvcgergffytpk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpjC (C:)
    giveqcctsicslyqlenycn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpjD (D:)
    fvnqhlcgshlvealylvcgergffytpka