PDB entry 1mpg

View 1mpg on RCSB PDB site
Description: 3-methyladenine dna glycosylase ii from escherichia coli
Deposited on 1997-10-28, released 1998-01-28
The last revision prior to the SCOP 1.55 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpgA (A:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpgB (B:)
    mytlnwqppydwswmlgflaaravssvetvadsyyarslavgeyrgvvtaipdiarhtlh
    inlsaglepvaaeclakmsrlfdlqcnpqivngalgrlgaarpglrlpgcvdafeqgvra
    ilgqlvsvamaakltarvaqlygerlddfpeyicfptpqrlaaadpqalkalgmplkrae
    alihlanaalegtlpmtipgdveqamktlqtfpgigrwtanyfalrgwqakdvflpddyl
    ikqrfpgmtpaqirryaerwkpwrsyallhiwytegwqpdea