PDB entry 1mpa

View 1mpa on RCSB PDB site
Description: bactericidal antibody against neisseria meningitidis
Class: complex (immunoglobulin/peptide)
Keywords: murine immunoglobulin igg2a kappa, bactericidal antibody, epitope p1.16 of pora from neisseria meningitidis, complex (immunoglobulin/peptide)
Deposited on 1997-02-26, released 1997-09-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: mn12h2 igg2a-kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR S38950 (3-224)
      • conflict (8-9)
      • conflict (11)
      • conflict (18-19)
      • conflict (27)
      • conflict (30)
      • conflict (32-33)
      • conflict (36)
      • conflict (42)
      • conflict (49)
      • conflict (54-56)
      • conflict (58)
      • conflict (60-62)
      • conflict (65)
      • conflict (68)
      • conflict (71-72)
      • conflict (75-76)
      • conflict (81)
      • conflict (87)
      • conflict (94)
      • insertion (96-99)
      • conflict (100-104)
      • conflict (106)
      • conflict (115)
    Domains in SCOPe 2.05: d1mpah1, d1mpah2
  • Chain 'L':
    Compound: mn12h2 igg2a-kappa
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-218)
      • conflict (1-2)
      • conflict (17)
      • conflict (27-28)
      • conflict (31)
      • conflict (38)
      • conflict (90-91)
      • conflict (93)
      • conflict (95-96)
    Domains in SCOPe 2.05: d1mpal1, d1mpal2
  • Chain 'P':
    Compound: pora p1.16 peptide fluorescein conjugate
    Database cross-references and differences (RAF-indexed):
    • PDB 1MPA (0-8)
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpaH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpti
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mpaL (L:)
    divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'P':
    No sequence available.