PDB entry 1mp9

View 1mp9 on RCSB PDB site
Description: TBP from a mesothermophilic archaeon, Sulfolobus acidocaldarius
Class: DNA binding protein
Keywords: transcription regulation, DNA-binding protein, transcription factor, DNA binding protein
Deposited on 2002-09-12, released 2003-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tata-binding protein
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mp9a1, d1mp9a2
  • Chain 'B':
    Compound: tata-binding protein
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mp9b1, d1mp9b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mp9A (A:)
    yiipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkit
    slifksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivn
    ldkaafllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifd
    klveldcvkpveeeelef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mp9A (A:)
    deipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitslif
    ksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivnldka
    afllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifdklve
    ldcvkpveeeele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mp9B (B:)
    yiipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkit
    slifksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivn
    ldkaafllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifd
    klveldcvkpveeeelef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mp9B (B:)
    ipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitsl
    ifksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivnld
    kaafllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifdkl
    veldcvkpv