PDB entry 1mp9

View 1mp9 on RCSB PDB site
Description: tbp from a mesothermophilic archaeon, sulfolobus acidocaldarius
Deposited on 2002-09-12, released 2003-11-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mp9A (A:)
    yiipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkit
    slifksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivn
    ldkaafllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifd
    klveldcvkpveeeelef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mp9A (A:)
    deipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitslif
    ksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivnldka
    afllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifdklve
    ldcvkpveeeele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mp9B (B:)
    yiipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkit
    slifksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivn
    ldkaafllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifd
    klveldcvkpveeeelef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mp9B (B:)
    ipdeipykavvnienivatvtldqtldlyamersvpnveydpdqfpglifrlespkitsl
    ifksgkmvvtgakstdelikavkriiktlkkygmqltgkpkiqiqnivasanlhvivnld
    kaafllennmyepeqfpgliyrmdeprvvllifssgkmvitgakredevhkavkkifdkl
    veldcvkpv