PDB entry 1mp8

View 1mp8 on RCSB PDB site
Description: Crystal structure of Focal Adhesion Kinase (FAK)
Class: transferase
Keywords: tyrosine protein kinase, TRANSFERASE
Deposited on 2002-09-11, released 2003-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.182
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FAK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mp8a_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mp8A (A:)
    gamgsstrdyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvr
    ekflqealtmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslil
    yayqlstalayleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklp
    ikwmapesinfrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmpp
    ncpptlyslmtkcwaydpsrrprftelkaqlstileeekaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mp8A (A:)
    dyeiqrerielgrcigegqfgdvhqgiymsppalavaiktcknctsdsvrekflqealtm
    rqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlstala
    yleskrfvhrdiaarnvlvssndcvklgdlpikwmapesinfrrftsasdvwmfgvcmwe
    ilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrprftelka
    qlstileeekaq