PDB entry 1mp1

View 1mp1 on RCSB PDB site
Description: Solution structure of the PWI motif from SRm160
Class: RNA binding protein
Keywords: four helix bundle, RNA BINDING PROTEIN
Deposited on 2002-09-11, released 2003-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ser/Arg-related nuclear matrix protein
  Species: Homo sapiens [TaxId:9606]
  Gene: SRm160
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8IYB3 (3-110)
    • cloning artifact (0-2)
  Domains in SCOPe 2.06: d1mp1a1, d1mp1a2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mp1A (A:)
  shmqlkfaeclekkvdmskvnlevikpwitkrvteilgfeddvviefifnqlevknpdsk
  mmqinltgflngknarefmgelwplllsaqeniagipsaflelkkeeikqr