PDB entry 1mp1

View 1mp1 on RCSB PDB site
Description: solution structure of the pwi motif from srm160
Deposited on 2002-09-11, released 2003-09-16
The last revision prior to the SCOP 1.67 freeze date was dated 2003-09-16, with a file datestamp of 2003-09-16.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mp1a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mp1A (A:)
shmqlkfaeclekkvdmskvnlevikpwitkrvteilgfeddvviefifnqlevknpdsk
mmqinltgflngknarefmgelwplllsaqeniagipsaflelkkeeikqr