PDB entry 1mp0

View 1mp0 on RCSB PDB site
Description: Binary Complex of Human Glutathione-Dependent Formaldehyde Dehydrogenase with NAD(H)
Class: oxidoreductase
Keywords: glutathione dependent Formaldehyde dehydrogenase, class III alcohol dehydrogenase, MAD, OXIDOREDUCTASE
Deposited on 2002-09-10, released 2002-09-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mp0a1, d1mp0a2
  • Chain 'B':
    Compound: Alcohol dehydrogenase class III chi chain
    Species: Homo sapiens [TaxId:9606]
    Gene: ADH5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mp0b1, d1mp0b2
  • Heterogens: ZN, K, PO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mp0A (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mp0B (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki