PDB entry 1mp0

View 1mp0 on RCSB PDB site
Description: Binary Complex of Human Glutathione-Dependent Formaldehyde Dehydrogenase with NAD(H)
Deposited on 2002-09-10, released 2002-09-25
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-25, with a file datestamp of 2002-09-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mp0A (A:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mp0B (B:)
    anevikckaavaweagkplsieeievappkahevrikiiatavchtdaytlsgadpegcf
    pvilghegagivesvgegvtklkagdtviplyipqcgeckfclnpktnlcqkirvtqgkg
    lmpdgtsrftckgktilhymgtstfseytvvadisvakidplapldkvcllgcgistgyg
    aavntaklepgsvcavfglggvglavimgckvagasriigvdinkdkfarakefgateci
    npqdfskpiqevliemtdggvdysfecignvkvmraaleachkgwgvsvvvgvaasgeei
    atrpfqlvtgrtwkgtafggwksvesvpklvseymskkikvdefvthnlsfdeinkafel
    mhsgksirtvvki