PDB entry 1mou

View 1mou on RCSB PDB site
Description: Crystal structure of Coral pigment
Class: luminescent protein
Keywords: blue coral pigment, chromophore, beta can fold, similar to Green fluorescent protein and DsRed, LUMINESCENT PROTEIN
Deposited on 2002-09-10, released 2003-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-18, with a file datestamp of 2020-03-13.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: GFP-like non-fluorescent chromoprotein
  Species: Montipora efflorescens [TaxId:105610]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83690 (2-220)
    • expression tag (0-1)
    • chromophore (61)
  Domains in SCOPe 2.08: d1moua1, d1moua2
• Heterogens: IOD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mouA (A:)
  ggviatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspq
  cqygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkf
  sglnfppngpvmqkktqgwephserlfarggmlignnfmalkleggghylcefkttykak
  kpvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva