PDB entry 1mom

View 1mom on RCSB PDB site
Description: crystal structure of momordin, a type i ribosome inactivating protein from the seeds of momordica charantia
Deposited on 1994-03-04, released 1994-05-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2.16 Å
R-factor: 0.186
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mom__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mom_ (-)
    dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
    tvaldvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
    prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
    lntrni