PDB entry 1mok

View 1mok on RCSB PDB site
Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase
Class: oxidoreductase
Keywords: Nucleotide binding motifs, Nucleotide binding domain, OXIDOREDUCTASE
Deposited on 2002-09-09, released 2002-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf3
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1moka1, d1moka2, d1moka3
  • Chain 'B':
    Compound: orf3
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mokb1, d1mokb2, d1mokb3
  • Chain 'C':
    Compound: orf3
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mokc1, d1mokc2, d1mokc3
  • Chain 'D':
    Compound: orf3
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mokd1, d1mokd2, d1mokd3
  • Heterogens: FAD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mokA (A:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mokA (A:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mokB (B:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mokB (B:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mokC (C:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mokC (C:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mokD (D:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mokD (D:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl