PDB entry 1moj

View 1moj on RCSB PDB site
Description: Crystal structure of an archaeal dps-homologue from Halobacterium salinarum
Class: DNA binding protein
Keywords: dps, ferritin, four-helix bundle, halophilic, DNA BINDING PROTEIN
Deposited on 2002-09-09, released 2004-04-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.147
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dps-like ferritin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1moja_
  • Chain 'B':
    Compound: Dps-like ferritin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mojb_
  • Chain 'C':
    Compound: Dps-like ferritin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mojc_
  • Chain 'D':
    Compound: Dps-like ferritin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1mojd_
  • Heterogens: FE, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mojA (A:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mojA (A:)
    stqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefr
    dlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslan
    dmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mojB (B:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mojB (B:)
    aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
    lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
    gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mojC (C:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mojC (C:)
    aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
    lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
    gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mojD (D:)
    mstqknaratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaef
    rdlhlflgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtsla
    ndmaiygdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqga
    le
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mojD (D:)
    aratagevegsdalrmdadraeqcvdalnadlanvyvlyhqlkkhhwnvegaefrdlhlf
    lgeaaetaeevadelaervqalggvphaspetlqaeasvdvededvydirtslandmaiy
    gdiieatrehtelaenlgdhatahmlreglieleddahhiehyleddtlvtqgal