PDB entry 1mog

View 1mog on RCSB PDB site
Description: Crystal structure of H. salinarum dodecin
Class: unknown function
Keywords: binding site for dimerized riboflavin, 23-symmetric dodecamer, UNKNOWN FUNCTION
Deposited on 2002-09-09, released 2003-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dodecin
  Species: Halobacterium salinarum [TaxId:2242]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9HPW4 (0-66)
  Domains in SCOPe 2.07: d1moga_
• Heterogens: MG, NA, CL, RBF, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mogA (A:)
  vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
  feldgsq