PDB entry 1mog

View 1mog on RCSB PDB site
Description: Crystal structure of H. salinarum dodecin
Class: unknown function
Keywords: binding site for dimerized riboflavin, 23-symmetric dodecamer, UNKNOWN FUNCTION
Deposited on 2002-09-09, released 2003-04-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dodecin
    Species: Halobacterium salinarum [TaxId:2242]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1moga_
  • Heterogens: MG, NA, CL, RBF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mogA (A:)
    vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgveigaveertyqtevqva
    feldgsq