PDB entry 1moe

View 1moe on RCSB PDB site
Description: The three-dimensional structure of an engineered scFv T84.66 dimer or diabody in VL to VH linkage.
Class: immune system
Keywords: anti carcinoembryonic antigen, T84.66, diabody, dimer, scFv, variable domain, IMMUNE SYSTEM
Deposited on 2002-09-09, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-CEA mAb T84.66
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01660 (0-110)
      • linker (111-118)
    • GB CAA36980 (119-239)
    Domains in SCOPe 2.07: d1moea1, d1moea2
  • Chain 'B':
    Compound: anti-CEA mAb T84.66
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01660 (0-110)
      • linker (111-118)
    • GB CAA36980 (119-239)
    Domains in SCOPe 2.07: d1moeb1, d1moeb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1moeA (A:)
    divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
    gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleikgggsgggge
    vqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnskyv
    pkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1moeB (B:)
    divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
    gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleikgggsgggge
    vqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnskyv
    pkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvss