PDB entry 1mod

View 1mod on RCSB PDB site
Description: high-resolution crystal structures of distal histidine mutants of sperm whale myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1994-12-01, released 1995-02-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.141
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • conflict (64)
      • conflict (122)
    Domains in SCOPe 2.03: d1moda_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1modA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkktgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg