PDB entry 1mod

View 1mod on RCSB PDB site
Description: high-resolution crystal structures of distal histidine mutants of sperm whale myoglobin
Deposited on 1994-12-01, released 1995-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 2 Å
R-factor: 0.1414
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mod__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mod_ (-)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkktgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg