PDB entry 1mo9

View 1mo9 on RCSB PDB site
Description: nadph dependent 2-ketopropyl coenzyme m oxidoreductase/carboxylase complexed with 2-ketopropyl coenzyme m
Class: oxidoreductase
Keywords: Nucleotide binding motifs, Nucleotide binding domain, OXIDOREDUCTASE
Deposited on 2002-09-08, released 2002-11-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-09, with a file datestamp of 2012-05-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.188
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf3
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mo9a1, d1mo9a2, d1mo9a3
  • Chain 'B':
    Compound: orf3
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mo9b1, d1mo9b2, d1mo9b3
  • Heterogens: FAD, KPC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mo9A (A:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mo9A (A:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mo9B (B:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mo9B (B:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl