PDB entry 1mo4

View 1mo4 on RCSB PDB site
Description: reca-atp-gamma-s complex
Deposited on 2002-09-07, released 2003-02-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-02-18, with a file datestamp of 2003-02-18.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.201
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mo4A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraelegemgdshvglqarlmsqalrkmt
    galnnsgttaifinqlrdkigvmfgspetttggkalkfyasvrmdvrrvetlkdgtnavg
    nrtrvkvvknkclapfkqaefdilygkgisregslidmgvdqglirksgawftyegeqlg
    qgkenarnflvenadvadeiekkikeklgigavvtddpsndgvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mo4A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraeleghvglqarlmsqalrkmtgalnn
    sgttaifinqlrdkigvmfgspetttggkalkfyasvrmdvrrvetlkdgtnavgnrtrv
    kvvknkclapfkqaefdilygkgisregslidmgvdqglirksgawftyegeqlgqgken
    arnflvenadvadeiekkikeklg