PDB entry 1mo3

View 1mo3 on RCSB PDB site
Description: reca-ADP complex
Class: hydrolase
Keywords: RECOMBINATION, DNA-REPAIR, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, Hydrolase
Deposited on 2002-09-07, released 2003-02-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-16, with a file datestamp of 2017-08-11.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RecA
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mo3a1, d1mo3a2
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mo3A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraelegemgdshvglqarlmsqalrkmt
    galnnsgttaifinqlrdkigvmfgspetttggkalkfyasvrmdvrrvetlkdgtnavg
    nrtrvkvvknkclapfkqaefdilygkgisregslidmgvdqglirksgawftyegeqlg
    qgkenarnflvenadvadeiekkikeklgigavvtddpsndgvlpapvdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mo3A (A:)
    mtqtpdrekalelavaqieksygkgsvmrlgdearqpisviptgsialdvalgigglprg
    rvieiygpessgkttvalhavanaqaaggvaafidaehaldpdyakklgvdtdsllvsqp
    dtgeqaleiadmlirsgaldivvidsvaalvpraelegemhvglqarlmsqalrkmtgal
    nnsgttaifinqlrtggkalkfyasvrmdvrrvetlkdgtnavgnrtrvkvvknkclapf
    kqaefdilygkgisregslidmgvdqglirksgawftyegeqlgqgkenarnflvenadv
    adeiekkikeklg