PDB entry 1mo1

View 1mo1 on RCSB PDB site
Description: crystal structure at 1.8 angstroms of seleno methionyled crh, the bacillus subtilis catabolite repression containing protein crh reveals an unexpected swapping domain as an untertwinned dimer
Class: transport protein
Keywords: Open-Faced B-sandwich, Phosphotransferase system, Swapping domain, TRANSPORT PROTEIN
Deposited on 2002-09-06, released 2003-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-84)
      • modified residue (47)
      • modified residue (50)
      • cloning artifact (85-86)
    Domains in SCOPe 2.05: d1mo1a_
  • Chain 'B':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-84)
      • modified residue (0)
      • modified residue (47)
      • modified residue (50)
      • cloning artifact (85-86)
    Domains in SCOPe 2.05: d1mo1b_
  • Chain 'C':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-84)
      • modified residue (47)
      • modified residue (50)
      • cloning artifact (85-86)
    Domains in SCOPe 2.05: d1mo1c_
  • Chain 'D':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-84)
      • modified residue (0)
      • modified residue (47)
      • modified residue (50)
      • cloning artifact (85-86)
    Domains in SCOPe 2.05: d1mo1d_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mo1A (A:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mo1B (B:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mo1C (C:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mo1D (D:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq