PDB entry 1mo1
View 1mo1 on RCSB PDB site
Description: crystal structure at 1.8 angstroms of seleno methionyled crh, the bacillus subtilis catabolite repression containing protein crh reveals an unexpected swapping domain as an untertwinned dimer
Class: transport protein
Keywords: Open-Faced B-sandwich, Phosphotransferase system, Swapping domain, TRANSPORT PROTEIN
Deposited on
2002-09-06, released
2003-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.55
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: HPr-like protein crh
Species: Bacillus subtilis [TaxId:1423]
Database cross-references and differences (RAF-indexed):
- Uniprot O06976 (0-84)
- modified residue (47)
- modified residue (50)
- cloning artifact (85-86)
Domains in SCOPe 2.05: d1mo1a_ - Chain 'B':
Compound: HPr-like protein crh
Species: Bacillus subtilis [TaxId:1423]
Database cross-references and differences (RAF-indexed):
- Uniprot O06976 (0-84)
- modified residue (0)
- modified residue (47)
- modified residue (50)
- cloning artifact (85-86)
Domains in SCOPe 2.05: d1mo1b_ - Chain 'C':
Compound: HPr-like protein crh
Species: Bacillus subtilis [TaxId:1423]
Database cross-references and differences (RAF-indexed):
- Uniprot O06976 (0-84)
- modified residue (47)
- modified residue (50)
- cloning artifact (85-86)
Domains in SCOPe 2.05: d1mo1c_ - Chain 'D':
Compound: HPr-like protein crh
Species: Bacillus subtilis [TaxId:1423]
Database cross-references and differences (RAF-indexed):
- Uniprot O06976 (0-84)
- modified residue (0)
- modified residue (47)
- modified residue (50)
- cloning artifact (85-86)
Domains in SCOPe 2.05: d1mo1d_ - Heterogens: SO4, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mo1A (A:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1mo1B (B:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1mo1C (C:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1mo1D (D:)
mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
vtliaqgedeqealeklaayvqeevlq