PDB entry 1mo0

View 1mo0 on RCSB PDB site
Description:
Deposited on 2002-09-06, released 2002-09-13
The last revision prior to the SCOP 1.63 freeze date was dated 2002-09-20, with a file datestamp of 2002-09-20.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mo0a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1mo0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mo0A (A:)
    stslykagltrkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaks
    klkagvlvaaqncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaekt
    vhaleagikvvfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtg
    ktasgeqaqevhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvgg
    aslkpdfvkiinarsta
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mo0B (B:)
    rkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaksklkagvlvaa
    qncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaektvhaleagikv
    vfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtgktasgeqaqe
    vhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvggaslkpdfvki
    inars