PDB entry 1mo0

View 1mo0 on RCSB PDB site
Description: Structural Genomics Of Caenorhabditis Elegans: Triose Phosphate Isomerase
Class: isomerase
Keywords: STRUCTURAL GENOMICS, Triose Phosphate Isomerase, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG
Deposited on 2002-09-06, released 2002-09-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10657 (21-266)
      • expression tag (12-20)
      • insertion (267-268)
    Domains in SCOPe 2.07: d1mo0a1, d1mo0a2
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mo0b_
  • Heterogens: ACT, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mo0A (A:)
    msyyhhhhhhlestslykagltrkffvggnwkmngdyasvdgivtflnasadnssvdvvv
    appapylayaksklkagvlvaaqncykvpkgaftgeispamikdlglewvilghserrhv
    fgesdaliaektvhaleagikvvfcigekleereaghtkdvnfrqlqaivdkgvsweniv
    iayepvwaigtgktasgeqaqevhewiraflkekvspavadatriiyggsvtadnaaelg
    kkpdidgflvggaslkpdfvkiinarstalsctcw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mo0A (A:)
    stslykagltrkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaks
    klkagvlvaaqncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaekt
    vhaleagikvvfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtg
    ktasgeqaqevhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvgg
    aslkpdfvkiinarsta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mo0B (B:)
    msyyhhhhhhlestslykagltrkffvggnwkmngdyasvdgivtflnasadnssvdvvv
    appapylayaksklkagvlvaaqncykvpkgaftgeispamikdlglewvilghserrhv
    fgesdaliaektvhaleagikvvfcigekleereaghtkdvnfrqlqaivdkgvsweniv
    iayepvwaigtgktasgeqaqevhewiraflkekvspavadatriiyggsvtadnaaelg
    kkpdidgflvggaslkpdfvkiinarstalsctcw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mo0B (B:)
    rkffvggnwkmngdyasvdgivtflnasadnssvdvvvappapylayaksklkagvlvaa
    qncykvpkgaftgeispamikdlglewvilghserrhvfgesdaliaektvhaleagikv
    vfcigekleereaghtkdvnfrqlqaivdkgvsweniviayepvwaigtgktasgeqaqe
    vhewiraflkekvspavadatriiyggsvtadnaaelgkkpdidgflvggaslkpdfvki
    inars