PDB entry 1mnu

View 1mnu on RCSB PDB site
Description: unliganded bactericidal antibody against neisseria meningitidis
Class: immune system
Keywords: murine immunoglobulin igg2a kappa, bactericidal antibody, epitope p1.16 of pora from neisseria meningitidis, unliganded, immune system
Deposited on 1999-04-30, released 1999-05-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: protein (igg2a-kappa antibody mn12h2 (heavy chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01863 (0-119)
      • see remark 999 (2)
      • see remark 999 (5)
      • cloning artifact (120-123)
    Domains in SCOPe 2.05: d1mnuh1, d1mnuh2
  • Chain 'L':
    Compound: protein (igg2a-kappa antibody mn12h2 (light chain))
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VCI6 (0-113)
      • see remark 999 (12)
      • cloning artifact (113)
    Domains in SCOPe 2.05: d1mnul1, d1mnul2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mnuH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnuH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnuL (L:)
    divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec