PDB entry 1mnu

View 1mnu on RCSB PDB site
Description: unliganded bactericidal antibody against neisseria meningitidis
Deposited on 1999-04-30, released 1999-05-06
The last revision prior to the SCOP 1.69 freeze date was dated 1999-05-06, with a file datestamp of 1999-05-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.231
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mnuH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpti
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnuH (H:)
    evnlqqsgtvlarpgasvrmsckasgysftsywlhwikqrpgqglewiggiypgnrdtry
    tqrfkdkakltavtsantaymelssltnedsavyycsiiyfdyadfimdywgqgttvtvs
    sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
    dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnuL (L:)
    divmtqtplslpvslgdkasiscrssqalvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvffcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec