PDB entry 1mnp

View 1mnp on RCSB PDB site
Description: manganese peroxidase
Class: peroxidase (donor: h2o2 oxidoreductase)
Keywords: heme peroxidase, peroxidase (donor: h2o2 oxidoreductase)
Deposited on 1995-01-27, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese peroxidase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mnpa_
  • Heterogens: CA, MN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnpA (A:)
    avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
    ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
    prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvaradk
    vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
    sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
    gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa