PDB entry 1mno

View 1mno on RCSB PDB site
Description: v68n myoglobin oxy form
Class: oxygen storage/transport
Keywords: myoglobin, oxy, oxygen storage/transport complex
Deposited on 1998-08-13, released 1998-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.191
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (myoglobin)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • engineered (67)
    Domains in SCOPe 2.08: d1mnoa_
  • Chain 'B':
    Compound: protein (myoglobin)
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02189 (0-152)
      • engineered (67)
    Domains in SCOPe 2.08: d1mnob_
  • Heterogens: HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnoA (A:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mnoB (B:)
    glsdgewqlvlnvwgkveadvaghgqevlirlfkghpetlekfdkfkhlksedemkased
    lkkhgntnltalggilkkkghheaeltplaqshatkhkipvkylefiseaiiqvlqskhp
    gdfgadaqgamskalelfrndmaakykelgfqg