PDB entry 1mnn

View 1mnn on RCSB PDB site
Description: Structure of the sporulation specific transcription factor Ndt80 bound to DNA
Class: transcription/DNA
Keywords: ig fold, protein_dna complex, transcription-DNA complex
Deposited on 2002-09-05, released 2002-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.195
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NDT80 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: NDT80
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38830
      • see remark 999 (145)
      • see remark 999 (199)
    Domains in SCOPe 2.08: d1mnna_
  • Chain 'B':
    Compound: 5'-d(*tp*gp*cp*gp*ap*cp*ap*cp*ap*ap*ap*ap*ap*c)-3'
  • Chain 'C':
    Compound: 5'-d(*ap*gp*tp*tp*tp*tp*tp*gp*tp*gp*tp*cp*gp*c)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mnnA (A:)
    mnementvpvlqddlvskyerelsteqeedtpviltqlnedgttsnyfdkrklkiaprst
    lqfkvgppfelvrdycpvveshtgrtldlriipridrgfdhideewvgykrnyftlvstf
    etancdldtflkssfdllvedssvegrlrvqyfaikikaknddddteinlvqhtakrdkg
    pqfcpsvcplvpsplpkhqtireasnvrnitkmkkydstfylhrdhvnyeeygvdsllfs
    ypedsiqkvaryervqfassisvkkpsqqnkhfslhvilgavvdpdtfhgenpgipydel
    alkngskgmfvylqemktppliirgrspsnyassqritvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mnnA (A:)
    viltqlnedgttsnyfdkrklkiaprstlqfkvgppfelvrdycpvveshtgrtldlrii
    pridrgfdhideewvgykrnyftlvstfetancdldtflkssfdllvgrlrvqyfaikik
    aknddddteinlvqhtakrdkgpqfcpsvcplvpsplpkhqtireasnvrnitkmkkyds
    tfylhrdhvnyeeygvdsllfsypedsiqkvaryervqfassisvkkpsqqnkhfslhvi
    lgavvdpdgipydelalkngskgmfvylqemktppliirgrspsnyassq
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.